PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G067100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 735aa    MW: 83677 Da    PI: 7.9586
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G067100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS342.85.9e-1053567261374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lL++cA+av+++d  la++l++++++++spdgd +qRla+y++ +L+arla+ + ++y +l +++ +    +e +++++l   ++P+l
  Sevir.3G067100.1.p 356 LRTLLIHCAQAVAADDRPLATELIKKIRQHSSPDGDCIQRLAFYLVDGLEARLAGIGRQVYLKLLTKRVT---DEELFKIYNLSLAAFPLL 443
                         6789*********************************************************888888877...688889999999****** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         ++s+  aN++Ilea  g+ +vHi+Df++  GlQWp+L+q+++++ + pp+lRiTg++ +++g    e +e+ g+rLa++A+ ++vpf+++ 
  Sevir.3G067100.1.p 444 RVSYTFANRTILEASRGQPKVHIVDFGMCFGLQWPSLIQKFSEQ-GVPPKLRITGIDVSRPGfgTLEITEQAGKRLADYANMFKVPFQYQG 533
                         ******************************************95.889**********99999899999********************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          +++r e++++e+L++++gE+l+Vn+ +q+++l de+v+++s+rd+vLk++++++Pkv+++   + +++s+ F +rf e l +ys+lfd++
  Sevir.3G067100.1.p 534 -ISSRYENIQIEDLNIEEGEVLIVNSLYQMKTLGDETVAMNSARDRVLKIMRRMNPKVFILGVVNGSYSSPFFITRFKELLFHYSSLFDMF 623
                         .7***************************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         ++++pr++e+r+ +E +l++re+ n+++cegaer+er et+++W++r  +aGF+++p++  + +++  + ++++ + +  +e+sg+l++gW
  Sevir.3G067100.1.p 624 DTNIPRDNEARKLIEGRLFRREALNIISCEGAERTERPETYKQWQARCLKAGFEQLPVDPAILNSILDMTKEIYHEDFVADEDSGWLLQGW 714
                         **************************************************************************999************** PP

                GRAS 363 kdrpLvsvSaWr 374
                         k+r + ++S W+
  Sevir.3G067100.1.p 715 KGRVMHAISKWK 726
                         ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.186330706IPR005202Transcription factor GRAS
PfamPF035142.0E-102356726IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 735 aa     Download sequence    Send to blast
MVIEPLSDDL HTITTTEQPY DGSCSSSQQQ LITTHNYRRS DPQFFPQPTN NESNTQLSNL  60
VTIPGMYNVS SNLRQSQLQT SAGFNPDYQR IRSNDNALHH ISRMLMEDID ERVGLHEGEA  120
ALHAAEKTFY DILGQVYPPS WPPLCSNNEV DDPDESSSSN YQKRPRRTSF TSDICSPSML  180
HALAAPLSPY NYGRSLFRPY QPLTSTGRAT RFGFPALQII RGPEDAKGFD KLVIYLDSDK  240
LSICRLTTKA KEVEKSKCAV FQITDHTNNP CTQYLGTREG RSSKQHANTI TCEISQNRKF  300
DRHLLWYRLD CFDETRSLRE LMAKQASMNS TKGQSKGPTQ QKSRGKRQIN KEVVDLRTLL  360
IHCAQAVAAD DRPLATELIK KIRQHSSPDG DCIQRLAFYL VDGLEARLAG IGRQVYLKLL  420
TKRVTDEELF KIYNLSLAAF PLLRVSYTFA NRTILEASRG QPKVHIVDFG MCFGLQWPSL  480
IQKFSEQGVP PKLRITGIDV SRPGFGTLEI TEQAGKRLAD YANMFKVPFQ YQGISSRYEN  540
IQIEDLNIEE GEVLIVNSLY QMKTLGDETV AMNSARDRVL KIMRRMNPKV FILGVVNGSY  600
SSPFFITRFK ELLFHYSSLF DMFDTNIPRD NEARKLIEGR LFRREALNII SCEGAERTER  660
PETYKQWQAR CLKAGFEQLP VDPAILNSIL DMTKEIYHED FVADEDSGWL LQGWKGRVMH  720
AISKWKPNES CTDQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-393607268375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963450.10.0PREDICTED: uncharacterized protein LOC101786830
SwissprotO809331e-140SCL9_ARATH; Scarecrow-like protein 9
TrEMBLK3ZCE30.0K3ZCE3_SETIT; Uncharacterized protein
STRINGSi024218m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150538118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-141GRAS family protein